Instructions to use andrewdalpino/ESM2-150M-Protein-Cellular-Component with libraries, inference providers, notebooks, and local apps. Follow these links to get started.
- Libraries
- Transformers
How to use andrewdalpino/ESM2-150M-Protein-Cellular-Component with Transformers:
# Use a pipeline as a high-level helper from transformers import pipeline pipe = pipeline("text-classification", model="andrewdalpino/ESM2-150M-Protein-Cellular-Component")# Load model directly from transformers import AutoTokenizer, AutoModelForSequenceClassification tokenizer = AutoTokenizer.from_pretrained("andrewdalpino/ESM2-150M-Protein-Cellular-Component") model = AutoModelForSequenceClassification.from_pretrained("andrewdalpino/ESM2-150M-Protein-Cellular-Component", device_map="auto") - Notebooks
- Google Colab
- Kaggle
ESM2 Protein Function Caller
An Evolutionary-scale Model (ESM) for protein function prediction from amino acid sequences using the Gene Ontology (GO). Based on the ESM2 Transformer architecture, pre-trained on UniRef50, and fine-tuned on the AmiGO dataset, this model predicts the GO subgraph for a particular protein sequence - giving you insight into the molecular function, biological process, and location of the activity inside the cell.
Note: This version only models the cellular component subgraph of the gene ontology.
What are GO terms?
"The Gene Ontology (GO) is a concept hierarchy that describes the biological function of genes and gene products at different levels of abstraction (Ashburner et al., 2000). It is a good model to describe the multi-faceted nature of protein function."
"GO is a directed acyclic graph. The nodes in this graph are functional descriptors (terms or classes) connected by relational ties between them (is_a, part_of, etc.). For example, terms 'protein binding activity' and 'binding activity' are related by an is_a relationship; however, the edge in the graph is often reversed to point from binding towards protein binding. This graph contains three subgraphs (subontologies): Molecular Function (MF), Biological Process (BP), and Cellular Component (CC), defined by their root nodes. Biologically, each subgraph represent a different aspect of the protein's function: what it does on a molecular level (MF), which biological processes it participates in (BP) and where in the cell it is located (CC)."
From CAFA 5 Protein Function Prediction
Code Repository
https://github.com/andrewdalpino/esm2-function-classifier
Model Specs
- Vocabulary Size: 33
- Embedding Dimensions: 640
- Attention Heads: 20
- Encoder Layers: 30
- Context Length: 1026
Basic Example
For a basic demonstration we can rank the GO terms for a particular sequence. For a more advanced example see the predict-subgraph.py source file.
import torch
from transformers import EsmTokenizer, EsmForSequenceClassification
model_name = "andrewdalpino/ESM2-35M-Protein-Molecular-Function"
tokenizer = EsmTokenizer.from_pretrained(model_name)
model = EsmForSequenceClassification.from_pretrained(model_name)
model.eval()
sequence = "MCNAWYISVDFEKNREDKSKCIHTRRNSGPKLLEHVMYEVLRDWYCLEGENVYMM"
top_k = 10
out = tokenizer(sequence)
input_ids = out["input_ids"]
input_ids = torch.tensor(input_ids, dtype=torch.int64).unsqueeze(0)
with torch.no_grad():
outputs = model.forward(input_ids)
probabilities = torch.sigmoid(outputs.logits.squeeze(0))
probabilities, indices = torch.topk(probabilities, top_k)
probabilities = probabilities.tolist()
terms = [model.config.id2label[index] for index in indices.tolist()]
print(f"Top {args.top_k} GO Terms:")
for term, probability in zip(terms, probabilities):
print(f"{probability:.4f}: {term}")
References:
- A. Rives, et al. Biological structure and function emerge from scaling unsupervised learning to 250 million protein sequences, 2021.
- Z. Lin, et al. Evolutionary-scale prediction of atomic level protein structure with a language model, 2022.
- G. A. Merino, et al. Hierarchical deep learning for predicting GO annotations by integrating protein knowledge, 2022.
- M. Ashburner, et al. Gene Ontology: tool for the unification of biology, 2000.
- Downloads last month
- 23
Model tree for andrewdalpino/ESM2-150M-Protein-Cellular-Component
Base model
facebook/esm2_t30_150M_UR50D